Xanthomonas arboricola: XB05_11910 Help Entry XB05_11910        CDS       T06096                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xar  Xanthomonas arboricola Pathway xar00290   Valine, leucine and isoleucine biosynthesis xar00650   Butanoate metabolism xar00660   C5-Branched dibasic acid metabolism xar00770   Pantothenate and CoA biosynthesis xar01100   Metabolic pathways xar01110   Biosynthesis of secondary metabolites xar01210   2-Oxocarboxylic acid metabolism xar01230   Biosynthesis of amino acids Module xar_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xar_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xar00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     XB05_11910    00660 C5-Branched dibasic acid metabolism     XB05_11910   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     XB05_11910   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     XB05_11910 Enzymes [BR:xar01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      XB05_11910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  AKC79364 LinkDB All DBs Position 2842222..2842479 Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVLGMTERRGFRPCAIQGASAPDDAGRWHLQLDVDSTRPPETL RLQLEKVYDCESVTITVLDSVEVAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgaagccggccgaaggcgcattggtgcgcgtgctc ggcatgaccgagcgacgcggcttccgcccctgcgccatccagggcgccagcgccccggac gatgccggccgctggcatctgcaactggacgtggacagcacccgcccgccggagacgctg cgcctgcagctggagaaggtgtacgactgcgagtcggtgacgatcaccgtgctggactcg gtcgaggtcgcggcgtga

DBGET integrated database retrieval system