Xanthomonas arboricola: XB05_15570 Help Entry XB05_15570        CDS       T06096                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xar  Xanthomonas arboricola Pathway xar01100   Metabolic pathways xar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XB05_15570    00074 Mycolic acid biosynthesis     XB05_15570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XB05_15570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKC81430 LinkDB All DBs Position complement(3688761..3689030) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVEANKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctggtcgaaagcctgaac ctggaagacgtccagcccgccgacatcgacccggaggcgccgttgttcaataccgggctg ggactggattcgatcgacgcgctggaactggcgctggcgatcagcaagcgctatggcttc cagctgcgctcggacaatgacgagaatcgtcgcatcttcgcgtcgctgcgcgcattgtcg gcgcatgtcgaagccaacaagaccgtctga

DBGET integrated database retrieval system