Xanthomonas sp. SS: HEP74_00934
Help
Entry
HEP74_00934 CDS
T09534
Name
(GenBank) TonB-like protein
KO
K02172
bla regulator protein blaR1
Organism
xas
Xanthomonas sp. SS
Pathway
xas01501
beta-Lactam resistance
Module
xas_M00627
beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:
xas00001
]
09160 Human Diseases
09175 Drug resistance: antimicrobial
01501 beta-Lactam resistance
HEP74_00934
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
xas01002
]
HEP74_00934
09183 Protein families: signaling and cellular processes
01504 Antimicrobial resistance genes [BR:
xas01504
]
HEP74_00934
Peptidases and inhibitors [BR:
xas01002
]
Metallo peptidases
Family M56
HEP74_00934
Antimicrobial resistance genes [BR:
xas01504
]
Gene sets
beta-Lactam resistance modules
beta-Lactam resistance, Bla system [MD:
M00627
]
HEP74_00934
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_M56
TonB_C
Peptidase_M48
Motif
Other DBs
NCBI-ProteinID:
QNH15811
LinkDB
All DBs
Position
1129150..1130682
Genome browser
AA seq
510 aa
AA seq
DB search
MSVETFVAGMWATALSGSVAIVLALALRAPLRRAFGAGVAYAVWGVVPLAMLAVLLPGDV
RPALPAALAMPQVWVGLPQESAGAAGAMTLASSHAALWMAALWLLGAAAMAAALWRQQQR
YRHSLGQLSPGTDGVLYAQHALHGPLVLGAWRPRVVLPMDFAQRYPPAQAQLVLAHERMH
IARGDTRHNLLLAALRCAYWFNPLLHWAAARFRFDQELACDAAVLARHPASRRSYAEAML
QTQLDATALPVGCHWQAGQTLRQRIGMLQRPTVRGWRRRAGIAVVAMATLCGGGAAWALQ
PLPASALAGSGIAPALADAQAPDAGALAGTTTAAGAAPADTGTRLPMLLASTADAATTSA
KRATVDAKPMAMPPPAYPRDALREGASGKLSLLVSVDAAGAVSDVQLLDRGTGNVALDQA
AIAAARKWRFVPAQKQGRTVASRLKIPVNFESGREPVDAPSGVPNASNYRWYLVDTEADD
APEQTCDVVSVDGQGPTRRVYCGMSIKTAK
NT seq
1533 nt
NT seq
+upstream
nt +downstream
nt
atgagcgttgaaaccttcgtagcggggatgtgggccacggcgctgtccggcagtgtggcg
atcgtgttggcgttggcgctgcgtgcgccgttgcggcgcgcgttcggtgccggcgtcgcc
tacgcggtatggggtgtggtgccgttggccatgctcgccgtactgctgcctggcgacgtg
cgtccggcgctgccggcggcattggcgatgccgcaggtctgggtcgggctgccgcaggaa
tccgctggcgctgccggtgcgatgacgctggcgagcagccatgccgccctgtggatggct
gccctctggctgcttggcgcggcggcgatggccgccgcgttgtggcggcagcagcagcgc
tatcggcatagcctgggccagctgtcgcccggcacagatggggtgctgtacgcacaacat
gccttgcacggtccgttggtgctcggcgcttggcgcccgcgggtggtgctgccgatggat
ttcgcgcagcgctatccgcccgcgcaggcgcaactggtgctggcccacgagcgcatgcac
atcgcccgcggcgacacccgccataacctgttgctggcggccttgcgctgtgcctactgg
ttcaaccccttgctgcactgggccgcggcgcggttccgcttcgaccaggaactggcctgc
gatgcggcggtgctggcacggcatcctgcctcgcgccgcagctacgccgaagcgatgctg
cagacccaactggatgcgactgcattgccggtgggctgccattggcaggccgggcagacc
ctgcggcagcggatcggcatgctgcagcggccgaccgtgcgcggctggcggcggcgtgcg
ggcatcgccgtggtggcgatggcgacgctgtgcggcggcggcgcggcatgggcgttgcaa
ccgctgccggcatccgcgctggcgggaagcggcattgcgcctgcgctggcggatgcgcaa
gcgccggatgcaggcgcgctggcggggaccactaccgccgcgggcgcagcgccggccgat
actggaacgcgcttgcccatgctgctcgcttcgacagccgatgctgcgaccacatccgcc
aagcgcgccaccgtggatgccaagccaatggccatgccgccaccggcctatccgcgcgac
gcactgcgcgagggcgcctcgggaaaactgtcgctgttggtgagcgtggatgcggccggc
gccgtcagcgatgtgcagttgcttgatcgtggtacgggcaatgtggcgctggaccaggcg
gcgattgccgccgccaggaagtggcgcttcgttccggcgcagaagcagggacggacggtg
gcgtcgcggttgaagataccggtcaacttcgaatccgggagggagcctgtggatgcgcca
tcgggggtccccaatgcatcgaactatcgctggtatctggtggatacggaggcggatgat
gcgcctgagcaaacctgcgacgttgtctctgtcgatgggcaagggccgacccggcgcgtg
tattgcggcatgtccatcaagacggccaagtga
DBGET
integrated database retrieval system