Xanthomonas sp. SS: HEP74_03416 Help Entry HEP74_03416       CDS       T09534                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xas  Xanthomonas sp. SS Brite KEGG Orthology (KO) [BR:xas00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xas03036]     HEP74_03416 Chromosome and associated proteins [BR:xas03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HEP74_03416 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF7342 Motif Other DBs NCBI-ProteinID:  QNH18244 LinkDB All DBs Position complement(4120398..4120661) Genome browser AA seq 87 aa AA seqDB search MSRLLLIVLLACTISSAIGVVYMRHRHRQLFVELSRLEHNRDELNIEFGRLQLEQATWAE SNRVDQVARERLGMKFPETGDIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccggctgctgctcatcgtgctgctcgcctgcaccatctcttcggcgatcggggtg gtgtacatgcgtcatcgccatcgccagctgttcgtcgagctgtcgcggctggagcacaac cgcgacgagctgaacatcgagttcggccggctgcagctggagcaggcgacctgggccgaa agcaatcgcgtcgaccaggtcgcgcgcgagcggctgggcatgaagtttccggaaaccggc gacatcgtggtggtgcggccatga

DBGET integrated database retrieval system