Xanthobacter autotrophicus: Xaut_0883 Help Entry Xaut_0883         CDS       T00581                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism xau  Xanthobacter autotrophicus Pathway xau01100   Metabolic pathways xau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Xaut_0883    00074 Mycolic acid biosynthesis     Xaut_0883   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Xaut_0883 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABS66134 UniProt:  A7IDP1 LinkDB All DBs Position 985078..985335 Genome browser AA seq 85 aa AA seqDB search MTLEHPDVYERLTDVFRDVFQDDDIVLFPEMTAADVDGWDSLANIRLILAVETAFSIRLS AAQAASLAKLGDLVNLIASKIQQKK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgacgctcgaacatccagacgtttatgaaagacttacggacgtgttccgtgatgtattt caggacgatgatattgtcttgtttccagaaatgacggccgccgatgtcgacggctgggac agtctggcaaatatcaggctcatcctggctgtggagacggccttttcgattcgcctttca gcggctcaggcggcctctcttgcgaagcttggagatctggtcaatctgattgccagtaag atacagcaaaaaaaataa

DBGET integrated database retrieval system