Xanthobacter autotrophicus: Xaut_3132 Help Entry Xaut_3132         CDS       T00581                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xau  Xanthobacter autotrophicus Pathway xau01100   Metabolic pathways xau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Xaut_3132    00074 Mycolic acid biosynthesis     Xaut_3132   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Xaut_3132 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB Motif Other DBs NCBI-ProteinID:  ABS68362 UniProt:  A7IK19 LinkDB All DBs Position 3474744..3474980 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVAEHLGVEPEKVTESASFIDDLGADSLDTVELVMAFEEAFNCEIPDDAA ETILTVGDAIKFLEKNAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgccgagcgggtgaagaagattgtcgcggagcatctgggggtggaaccc gagaaggtcacggagagcgcctccttcatcgacgatctcggcgccgacagcctcgacacc gtggaactcgtgatggccttcgaggaggctttcaactgcgagatcccggacgatgccgcc gagacgatcctgaccgtgggtgacgcgatcaagttcctggaaaagaacgcggcttga

DBGET integrated database retrieval system