KEGG   Xanthobacter autotrophicus: Xaut_5018
Entry
Xaut_5018         CDS       T00581                                 

Name
(GenBank) cobalamin B12-binding domain protein
  KO
K20907  2-hydroxyisobutanoyl-CoA mutase small subunit [EC:5.4.99.64]
Organism
xau  Xanthobacter autotrophicus
Brite
KEGG Orthology (KO) [BR:xau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Xaut_5018
Enzymes [BR:xau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.64  2-hydroxyisobutanoyl-CoA mutase
     Xaut_5018
SSDB
Motif
Pfam: B12-binding Aldolase IMPDH
Other DBs
NCBI-ProteinID: ABS70216
UniProt: A7IQC0
LinkDB
Position
pXAUT01:236611..237018
AA seq 135 aa
MAQPIRVLLAKVGLDGHDRGVKVVARTLRDAGMDVIYSGLHRTPEEVVTAAVQEDVDILG
VSLLSGVQLTVFPKIFKLLAERGADDLIVIAGGVMPDEDVVALKELGVKEVMLQDTPPKA
IVETLERLVAERGPR
NT seq 408 nt   +upstreamnt  +downstreamnt
atggctcagccgatcagggtgctgctcgccaaagtcgggctcgacggtcacgatcgcggc
gtgaaggtggtggcgcgcaccctgcgcgacgccggcatggacgtgatttattccggcctc
caccgcacgcccgaggaagttgtgaccgcggcggtgcaggaggacgtggacatcctcggc
gtctccctcctctccggagtccagctcacggtctttcccaagatcttcaagctgctcgcc
gagcggggcgcggacgacctcatcgtgatcgccggcggcgtgatgccggacgaggacgtg
gtcgctctgaaggaactgggtgtgaaggaggtgatgctccaggacaccccgcccaaggcc
atcgtggaaacgctcgagcgcctggtcgccgagcgcggacctcgttga

DBGET integrated database retrieval system