KEGG   Xanthomonas sp. CPBF 426: XSP_002632
Entry
XSP_002632        CDS       T10769                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K18893  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
xaz  Xanthomonas sp. CPBF 426
Pathway
xaz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xaz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    XSP_002632
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xaz02000]
    XSP_002632
Transporters [BR:xaz02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    XSP_002632
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N RsgA_GTPase MMR_HSR1 AAA_16 AAA_29 AAA_22 AAA_21 UvrA_inter DUF87 AAA_7 HUTI_composite_bact AAA_33 AAA_5 Activator-TraM AAA_18 CyanoTRADDas_TM P-loop_TraG DUF996
Other DBs
NCBI-ProteinID: CAD1793429
LinkDB
Position
1:complement(3067815..3069647)
AA seq 610 aa
MFRWFESLIDVFPPIERDMPPRSVWRFYLHYLRPLWPILLATLIAGLLLALVEVAMFDFL
GRIVDMLAERPGADFFRRHAGELTWMAAITLVARPLFTGLHNLLVNQAIVPGLSNRSRWL
MHNYVVRQSLGFFNNDFAGRIANRVMQTGTSLRESAVQMVDALWYIVVYTGSALWLFAQA
DPWLMLPLLIWLVVYVALMAFFVPRMKARAWIASDARSKATGRIVDGYTNISTLKLFAHA
GREQAYVRDAIDELAVKHRGQTRVTTTMDTAIAVANGFLIVGTCGLALWLWSRGQISVGA
ITLATGLVIRIHNMSGWIMWTVNGIFEDIGSVQDGMQTISQPVLVQDAPGAVPLQVTQGQ
VQFEHIHFHYGKRGGVIAGLDLQVRAGEKIGLVGPSGAGKSTLVNVLLRLYDLEQGRILI
DGQDIAQVTQESLRGQIGLVTQDTSLLHRSIRDNLLYGRPQASDAQMLEAVRKARAESFI
DTLVDGEGRRGYDAYVGERGVKLSGGQRQRIAIARVLLKDAPILILDEATSALDSEVEAA
IQDSLDALMGNKTVIAIAHRLSTIARMDRLVVMDAGRIVETGTHAQLIAQGGLYARLWAR
QTGGFVAADG
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgtttcgctggttcgaatccctgatcgatgtcttcccgcccatcgagcgggacatgccg
ccacgtagcgtgtggcggttctacctgcattacctgcgtccgttgtggccgatcctgctg
gccacgctgatcgccggattgttgctggccctggtggaagtggcgatgttcgacttcctc
gggcgcatcgtcgacatgctggccgagcgaccgggagcggacttctttcgccggcatgcc
ggcgagttgacctggatggcagcgatcacgctggtggcacggccattgttcaccggcctg
cacaacctgttggtcaaccaggcgatcgtgccggggctgagcaaccgctcgcgctggctg
atgcacaactacgtggtgcggcagagcctgggcttcttcaacaacgatttcgccggccgg
atcgccaaccgggtgatgcagaccgggacctcgctgcgcgaatcggcggtgcagatggtc
gatgcgctctggtacatcgtggtctacaccggcagcgcgctgtggttgtttgcgcaggcc
gacccgtggctgatgctgccgctgctgatctggctggtggtgtacgtcgcgttgatggcg
ttcttcgtgccgcgcatgaaggcgcgcgcgtggatcgcatcggatgcgcgctccaaggcc
accgggcgcatcgtcgacggctacaccaatatctccacgttgaagctgtttgcccacgcc
ggccgcgaacaggcctatgtgcgcgatgcgatcgacgagctggcggtgaaacatcgcggg
cagacccgcgtgaccaccaccatggataccgccattgcggtggccaacggctttctgatc
gtcggtacgtgcgggctggcgttgtggctgtggagccgcggccagatcagcgtgggcgcg
atcacgctggcgaccggcctggtgatccgcatccacaacatgtccggctggatcatgtgg
acggtcaacggcatcttcgaagacatcggcagcgtgcaggacggcatgcagaccatctcg
cagccggtgctggtgcaggacgcgcccggcgcagtgccgctgcaggtgacccagggccag
gtgcagttcgagcacatccatttccattacggcaagcgcggcggggtgatcgccgggctg
gatctgcaggtgcgtgccggcgagaagatcggcctggtcggcccatcgggcgcgggcaag
tcgaccctggtcaacgtgttgctgcgtctgtacgacctggagcagggacgcatcctcatc
gacgggcaggacatcgcccaggtcacccaggaaagcctgcgcgggcagatcggcctggtg
acccaggacacctcgctattgcaccgttcgatccgcgacaacctgctgtatggccggccg
caggccagcgacgcgcagatgctggaagcggtgcgcaaggcgcgcgcggaaagcttcatc
gacacgctggtcgatggcgaaggccggcgcggatacgatgcgtacgtgggcgagcgcggg
gtcaagctgtcgggtggtcaacggcagcgcatcgccatcgcgcgggtgctgctgaaggat
gcgccgatcctgatcctggacgaggccacctcggcgctggattcggaagtggaagcggcg
atccaggacagcctggacgcattgatgggcaacaagaccgtcatcgcgatcgcgcaccgc
ctgtccaccatcgcgcgcatggaccggctggtggtgatggacgccggacgcatcgtcgag
accggcacgcatgcgcagctgatcgcgcagggcgggctgtacgcacgcctgtgggcgcgg
caaaccggcgggttcgttgcggccgatgggtga

DBGET integrated database retrieval system