Ahniella affigens: C7S18_01275 Help Entry C7S18_01275       CDS       T05483                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xba  Ahniella affigens Brite KEGG Orthology (KO) [BR:xba00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xba03036]     C7S18_01275 (ftsL) Chromosome and associated proteins [BR:xba03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     C7S18_01275 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC APG6_N SIT Motif Other DBs NCBI-ProteinID:  AVP95911 UniProt:  A0A2P1PM38 LinkDB All DBs Position 361357..361626 Genome browser AA seq 89 aa AA seqDB search MSWRWLLVLLTLILTIASAIAVVKSRQESRRLFIELNQLERERDELNTEFGRLQLEQATL TDSSRLEQFASSQMGMIYPGPAETVVIRR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagctggcggtggttgctggtgttgttgaccctgattctgaccatcgcgagtgccatc gcggtggtcaaaagccggcaggagagccggcgcctgttcatcgagctcaatcagctcgag cgggagcgggacgaactcaataccgagttcggccgtctgcaactggaacaggccacgctg accgacagctcccgtttggagcagttcgccagcagtcaaatgggaatgatttacccgggt ccagccgagacggtggtgatccggcggtag

DBGET integrated database retrieval system