Ahniella affigens: C7S18_05360 Help Entry C7S18_05360       CDS       T05483                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xba  Ahniella affigens Pathway xba01100   Metabolic pathways xba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7S18_05360    00074 Mycolic acid biosynthesis     C7S18_05360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7S18_05360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AVP96665 UniProt:  A0A2P1PPA8 LinkDB All DBs Position 1429221..1429463 Genome browser AA seq 80 aa AA seqDB search MSSIEERVKKIVVEQLGVKQEEVTANASFVDDLGADSLDTVELVMALEEEFECEIPDEDA EKITSVQMAIDYIKTHVDKA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagaacgcgtcaaaaagatcgtggtcgaacaactcggcgtgaagcag gaagaagtcaccgccaatgcgtcgtttgttgatgacctgggcgccgactcgctggacacg gtggaactggtgatggcgcttgaagaagaattcgagtgcgaaatcccggacgaagatgct gagaagatcaccagcgtgcagatggcgatcgattacatcaagacgcacgtcgacaaggcc tga

DBGET integrated database retrieval system