Ahniella affigens: C7S18_22550 Help Entry C7S18_22550       CDS       T05483                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xba  Ahniella affigens Pathway xba01100   Metabolic pathways xba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7S18_22550    00074 Mycolic acid biosynthesis     C7S18_22550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7S18_22550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVQ00235 UniProt:  A0A2P1PZI6 LinkDB All DBs Position 5786136..5786405 Genome browser AA seq 89 aa AA seqDB search MQTQSPAERELAELLVSALNLESIQPEQIDPEQALFGADLGLDSIDALELALAVSKKYGF QLRSDNEDNRRIFASLRALSAHIEANRAM NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcaaacacaatccccagccgagcgcgagctggctgagctcctggtttccgccctgaat ctggaatccatccagcccgaacaaatcgatcctgagcaggcgctgtttggcgccgatctg ggtctcgactccatcgacgcgctggagctggcgttggccgtgtccaagaaatatggcttt cagctgcgttccgataacgaagataatcgtcgcatctttgcctcgctgcgggcgctgtca gcgcacatcgaagccaatcgcgcaatgtga

DBGET integrated database retrieval system