Pseudolysobacter antarcticus: ELE36_03740 Help Entry ELE36_03740       CDS       T06010                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xbc  Pseudolysobacter antarcticus Brite KEGG Orthology (KO) [BR:xbc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xbc03036]     ELE36_03740 (ftsL) Chromosome and associated proteins [BR:xbc03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ELE36_03740 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QBB69561 UniProt:  A0A411HGH2 LinkDB All DBs Position 870541..870813 Genome browser AA seq 90 aa AA seqDB search MRRAGLFALTVLLLAVIGSAIAVVFERQEGRLQFVELDRLQKERDEMNFEWGRLQIEQAT WAENNRIEQIARSQLGMVSPSAAETVIIKR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaggcgcgcaggattatttgcgctgaccgtgttgctgctcgcggtgatcggtagcgcg attgcggtggtgttcgagcggcaggaaggtcgactgcaatttgtcgaactggatcggctg caaaaagaacgcgatgaaatgaatttcgagtggggccgtctgcaaattgagcaggcgacc tgggcggaaaacaaccgaatagaacagattgcacgcagtcagctcggcatggtttcgccc agcgctgcggagacggtcatcataaaaaggtga

DBGET integrated database retrieval system