Pseudolysobacter antarcticus: ELE36_05615 Help Entry ELE36_05615       CDS       T06010                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xbc  Pseudolysobacter antarcticus Pathway xbc01100   Metabolic pathways xbc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xbc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ELE36_05615    00074 Mycolic acid biosynthesis     ELE36_05615   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ELE36_05615 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF6137 PP-binding_2 DUF8540 Motif Other DBs NCBI-ProteinID:  QBB69886 UniProt:  A0A411HH80 LinkDB All DBs Position 1321885..1322151 Genome browser AA seq 88 aa AA seqDB search MSNVQETIFAIIAKESGIEASKITLESTLKDLEIDSLDAVQIIFELEDKFKITLPDRDPT VDTDSVQGLVTAVERLIAEKEAGAPVLS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagtaatgtgcaggaaaccattttcgccatcatcgccaaggaatcgggcattgaggcg agcaagatcacgctcgaatccacattgaaggacctcgaaatcgattcgctcgatgcggtg cagatcattttcgagctcgaagacaaattcaagatcaccttgcccgatcgcgacccgact gtcgacactgattcggtgcagggtctggtgaccgcggtcgaacgcttgatcgcagagaaa gaagccggcgctcccgtgctgagctga

DBGET integrated database retrieval system