Pseudolysobacter antarcticus: ELE36_17910 Help Entry ELE36_17910       CDS       T06010                                  Name (GenBank) DNA-binding protein   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism xbc  Pseudolysobacter antarcticus Brite KEGG Orthology (KO) [BR:xbc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:xbc03000]     ELE36_17910    03036 Chromosome and associated proteins [BR:xbc03036]     ELE36_17910    03400 DNA repair and recombination proteins [BR:xbc03400]     ELE36_17910 Transcription factors [BR:xbc03000]  Prokaryotic type   Helix-turn-helix    Other families     ELE36_17910 Chromosome and associated proteins [BR:xbc03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ELE36_17910 DNA repair and recombination proteins [BR:xbc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       ELE36_17910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HTH_8 HTH_30 Xre-like-HTH DUF3613 HTH_50 Motif Other DBs NCBI-ProteinID:  QBB72091 UniProt:  A0A411HNN7 LinkDB All DBs Position 4179357..4179632 Genome browser AA seq 91 aa AA seqDB search MTPPTPSRTDSASDQLQPALRECVTRAVRRYLSDLGTQVPDGLYELVMQEVEVPLLKEVL SCYNGNQSKSAAALGINRATLRKKLAQHDLG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgactcctcctactccttcccgcaccgattcggcctccgaccaactgcaacccgccttg cgcgaatgcgttacgcgcgcggtgcggcgttatctttccgatctcggcacgcaggtgccc gacgggctgtacgagctggtcatgcaggaagtcgaagtgccgctgctgaaagaagttcta tcctgctacaacggcaatcagagcaagagcgcggcagcgctcggcatcaaccgcgcaact ctgcgcaagaagctcgcgcaacacgatctgggctga

DBGET integrated database retrieval system