KEGG   Xanthomonas bundabergensis: AB3X10_13690
Entry
AB3X10_13690      CDS       T10887                                 
Symbol
msbA
Name
(GenBank) lipid A export permease/ATP-binding protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
xbn  Xanthomonas bundabergensis
Pathway
xbn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xbn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AB3X10_13690 (msbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xbn02000]
    AB3X10_13690 (msbA)
Enzymes [BR:xbn01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     AB3X10_13690 (msbA)
Transporters [BR:xbn02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    AB3X10_13690 (msbA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA_30 DUF3584 nSTAND1 ABC_ATPase AAA_29 AAA_21 AAA_23
Other DBs
NCBI-ProteinID: XEA89240
LinkDB
Position
complement(3243184..3244932)
AA seq 582 aa
MSAKSAPVWPIYRRLLGYTHAYWAMLSAAVVAMVIEATAGYFFTRLMDPLVNRGFVNPEP
RMAVLLPMAILGLFLMRSVATFVGDYCMARTGRSVVRDLREQVLAKYLHLPSSHFDVEAT
PVMVSRLNFDTEQVTQAASDALKTLVADTLTIIGMLVVMLQMSVKVTLALLVVAPLIGVI
VSYVGKRYRKISRGIQDGMGSMAQRAEQSLGAQQEVKVHGTQALEISHYAALANRMLGLN
MKVETTRALASSMVQFLAAVALAAIVWVATREALAGRLNAGQFMALMTSMMAIIPSLRRL
TSVQTSISRGVAAAERLFSILDTPEERDTGTVSVQRVRGELAFDKVMLRYRQDSGLALDD
ISFSAGPGTVTAIVGRSGSGKTSLVRLVPRFYEPSGGRITLDGVPLHDYRLHDLRRQIAL
VGQRVMLFDDTIAANIAYGTQASDAQIRAAAEAANAWEFIERLPLQLRTPVGENGALLSG
GQRQRLAIARAILRDAPILILDEATAALDNESERLVQDALHRLMPERTTLVIAHRLSTIE
HADQVLVMDHGRIVERGTHHALLAQGGLYAHLHSMQFRERQP
NT seq 1749 nt   +upstreamnt  +downstreamnt
gtgagcgccaagtcggcaccggtctggccgatctaccgtcggctgctcggatatacccac
gcctactgggcgatgctgagcgcggcagtggtggcgatggtgatcgaggccaccgccggc
tatttcttcacccggctgatggatccgctggtcaaccgcggcttcgtcaatcccgagccg
cgcatggcggtgctgctgccgatggcgatcctgggcctgttcctgatgcgcagcgtcgcc
accttcgtcggcgactactgcatggcgcgcaccggccgcagcgtggtgcgcgacctgcgc
gagcaggtgctggccaagtacctgcacctgccgtcctcgcatttcgacgtcgaggccacg
ccggtgatggtcagccggctcaacttcgataccgagcaggtcacccaggccgcctccgac
gcgctgaagacgctggtggccgacaccctgaccatcatcggcatgctggtggtgatgctg
cagatgagcgtcaaggtgaccctggcgttgctggtggtggcgccgctgatcggggtcatc
gtgtcctacgtcggcaagcgctaccgcaagatcagccgcggcatccaggacggcatgggc
tcgatggcgcagcgcgccgaacagtcgctgggcgcgcagcaggaagtgaaggtgcacggt
acccaggccctggagatcagccactacgcggcgctggccaaccgcatgctgggcctgaac
atgaaggtcgagaccacccgcgcgctggcctcgagcatggtccagttcctggccgcggtg
gcgctggcggcgatcgtctgggtcgccacccgcgaggcgctggccgggcgcctcaacgcc
ggccagttcatggcgctgatgacctcgatgatggcgatcatcccgtcgctgcgccgcttg
accagcgtgcagacctcgatctcgcgcggcgtggccgccgccgagcggctgttctcgatc
ctggatacgccggaggagcgcgacaccggcaccgtgtcggtacagcgcgtgcgcggcgag
ctggcgttcgacaaggtgatgctgcgctaccgccaggacagcggcctggccctggacgac
atcagtttcagcgccgggccgggcacggtcaccgccatcgtcggccgctccggcagcggc
aagaccagcctggtgcggctggtgccgcgcttctacgaacccagcggcggccgcatcacc
ctggacggggtgccgctgcacgactaccgcctgcacgacctgcgccggcagatcgcgctg
gtcgggcagcgggtgatgctgttcgacgacaccatcgccgccaacatcgcctacggcacg
caggccagcgacgcgcagatccgcgccgccgccgaggcggccaacgcctgggagttcatc
gagcgcctgccgctgcagttgcgcacgccggtgggcgagaacggcgcgctgctgtccggc
ggccagcgccagcgcctggccatcgcccgcgcgatcctgcgcgacgcgccgatcctgatc
ctggacgaggccaccgccgcgctggacaacgaatccgagcgcctggtgcaggacgcgctg
caccggctgatgcccgagcgcaccaccctggtgatcgcgcaccgcctgtccaccatcgaa
cacgccgaccaggtgctggtgatggaccacggccgcatcgtcgagcgcggcacccaccac
gcgctgctcgcccagggcgggctgtacgcccatctgcacagcatgcagttccgcgaaagg
cagccctga

DBGET integrated database retrieval system