KEGG   Xanthomonas bundabergensis: AB3X10_14655
Entry
AB3X10_14655      CDS       T10887                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
xbn  Xanthomonas bundabergensis
Brite
KEGG Orthology (KO) [BR:xbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xbn03016]
    AB3X10_14655 (truB)
Enzymes [BR:xbn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     AB3X10_14655 (truB)
Transfer RNA biogenesis [BR:xbn03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    AB3X10_14655 (truB)
 Prokaryotic type
    AB3X10_14655 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 TruB_C
Other DBs
NCBI-ProteinID: XEA89417
LinkDB
Position
complement(3485872..3486798)
AA seq 308 aa
MPVFGPRLPRISFRRLDGIVLLDKPAGMSSNAALQAARRLFRAEKGGHTGSLDPLATGLL
PLCFGEATKLAGLLLGSAKAYEAEIVLGVSTDSDDADGAVLRTRPVPPIDAATLQAALAP
LRGRIRQRAPIYSALKQGGEPLYAKARRGEAIEAPEREVEVHAIEVLEHVGERLRLHVAC
GSGTYIRSLARDLGEALGCGAHIAGLRRLWVEPFREPRMATLEQLQRLAAQDPAALEALL
LPLAAGLADFPPLRLDHAAAQRFRMGQRLREAAWAPGAVAVFGADGVPLGLGQVDDSGLL
APQRMFNL
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcccgtcttcggcccccgactgccacgcatttccttccgccgcctcgacggcatcgtg
ctgctcgacaagccggccggcatgagttccaacgccgcgctgcaagcggcgcggcggctg
ttccgtgcggagaagggcggccataccggcagcctggacccgctggccaccggcctgctg
ccgctgtgcttcggcgaggcgaccaagctggccgggctgctgctgggctcggccaaggcc
tacgaggccgagatcgtgctcggggtgagcaccgacagcgacgatgccgatggcgcggtg
ctgcgcacccggccggtaccgccgatcgatgcggcgaccctgcaggcggcgctggcgccg
ctgcgcgggcgcatccgccagcgcgcgccgatctattcggcgctcaagcagggcggcgag
ccgctgtacgcgaaggcgcgccgcggcgaggcgatcgaggcgccggagcgcgaggtcgag
gtgcacgccatcgaggtgctggagcacgtgggcgagcgcctgcgcctgcacgtggcctgc
ggctccggcacctatatccgcagcctggcccgcgacctgggcgaggcgctgggctgcggc
gcgcatatcgccgggctgcggcggctgtgggtggagccgttccgggagccgcggatggcg
accctggagcagctgcagcgcctggccgcgcaggatccggcggcgctggaggcgctgctg
ctgccgctggccgccggcctggccgatttcccgccgctgcgcctggaccatgctgcggcg
cagcgctttcgcatgggccagcgcctgcgcgaggccgcctgggcgccgggcgcggtcgcg
gtgttcggcgccgacggcgtgccgctggggctgggccaggtcgacgacagcgggctgctg
gcgccgcagcgcatgttcaatctctga

DBGET integrated database retrieval system