Xenorhabdus bovienii SS-2004: XBJ1_1051 Help Entry XBJ1_1051         CDS       T01186                                  Name (GenBank) Protein ybgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism xbo  Xenorhabdus bovienii SS-2004 Pathway xbo00190   Oxidative phosphorylation xbo01100   Metabolic pathways xbo02020   Two-component system Module xbo_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:xbo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     XBJ1_1051  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     XBJ1_1051 Enzymes [BR:xbo01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      XBJ1_1051 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CBJ80192 LinkDB All DBs Position complement(1041848..1041964) Genome browser AA seq 38 aa AA seqDB search MWYFAWILGTLLACSFAIIAALALEQSESKKATESGEK NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcttggattctcggaacgctcttagcttgtagtttcgctatcattgca gccttggcacttgagcagagcgaatcaaaaaaagcgactgagagtggcgaaaaataa

DBGET integrated database retrieval system