Xenorhabdus bovienii SS-2004: XBJ1_2857 Help Entry XBJ1_2857         CDS       T01186                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xbo  Xenorhabdus bovienii SS-2004 Pathway xbo01100   Metabolic pathways xbo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xbo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XBJ1_2857 (acpP)    00074 Mycolic acid biosynthesis     XBJ1_2857 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XBJ1_2857 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Ribosomal_L50 DUF5798 Motif Other DBs NCBI-ProteinID:  CBJ81981 UniProt:  D3V819 LinkDB All DBs Position complement(2807759..2807995) Genome browser AA seq 78 aa AA seqDB search MSTIDERVKKIIVEQLGVKEEEVVNTASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDYVENAGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgacgaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagag gaagaagttgtaaatacagcttcatttgttgatgacttgggcgctgattctcttgacaca gttgaactggtaatggctctggaagaagagttcgatatcgagatcccagacgaagaagct gaaaaaatcactacagttcaggctgctattgactacgttgaaaacgcaggtaaataa

DBGET integrated database retrieval system