Xenorhabdus budapestensis: HGO23_17950 Help Entry HGO23_17950       CDS       T07176                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism xbu  Xenorhabdus budapestensis Pathway xbu02024   Quorum sensing xbu03018   RNA degradation Brite KEGG Orthology (KO) [BR:xbu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HGO23_17950 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HGO23_17950 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xbu03019]     HGO23_17950 (hfq)    03036 Chromosome and associated proteins [BR:xbu03036]     HGO23_17950 (hfq) Messenger RNA biogenesis [BR:xbu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HGO23_17950 (hfq) Chromosome and associated proteins [BR:xbu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HGO23_17950 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QTL39639 UniProt:  A0A2D0J553 LinkDB All DBs Position complement(4064924..4065226) Genome browser AA seq 100 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHGSNANVGSSVGNYQANTSSAAQQENDIAE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccattcctgaacgcattacgacgtgaaagggtc ccggtttctatttatttagtcaacggcatcaaattgcagggtcaaattgaatcttttgac caatttgtcattttgctgaaaaacacagtcagtcagatggtttataaacacgccatttct actgttgtgccttcccgcccagtgtctcaccatggtagcaatgcaaatgtgggatccagt gtaggaaattatcaggctaatactagctcggcggcacaacaggaaaatgatatcgctgaa taa

DBGET integrated database retrieval system