Xenorhabdus bovienii CS03: XBW1_4461 Help Entry XBW1_4461         CDS       T03845                                  Symbol hfq Name (GenBank) Protein hfq   KO K03666   host factor-I protein Organism xbv  Xenorhabdus bovienii CS03 Pathway xbv02024   Quorum sensing xbv03018   RNA degradation Brite KEGG Orthology (KO) [BR:xbv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     XBW1_4461 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     XBW1_4461 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xbv03019]     XBW1_4461 (hfq)    03036 Chromosome and associated proteins [BR:xbv03036]     XBW1_4461 (hfq) Messenger RNA biogenesis [BR:xbv03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      XBW1_4461 (hfq) Chromosome and associated proteins [BR:xbv03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     XBW1_4461 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  CDM91810 UniProt:  A0A0B6XE59 LinkDB All DBs Position complement(4330741..4331043) Genome browser AA seq 100 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHGNNPNVTTGVGNYHAGANPAAQPESDGAE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccattcctgaacgcgttacggcgtgaaagggtc ccggtttctatttatttggtcaacggcatcaagttacagggtcagattgaatcttttgac caatttgttattttactgaaaaacacggtcagtcagatggtttataaacatgccatttca actgttgtgccttcccgtcctgtgtctcaccacggcaataatccgaacgtgacgactggc gttggaaattatcatgctggcgctaacccagcagcacaaccggaaagtgatggcgctgaa taa

DBGET integrated database retrieval system