Xylanimonas cellulosilytica: Xcel_0785 Help Entry Xcel_0785         CDS       T01135                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism xce  Xylanimonas cellulosilytica Brite KEGG Orthology (KO) [BR:xce00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Xcel_0785 Enzymes [BR:xce01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Xcel_0785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin GST_N_3 Glrx-like Motif Other DBs NCBI-ProteinID:  ACZ29823 UniProt:  D1BXL3 LinkDB All DBs Position complement(856461..856706) Genome browser AA seq 81 aa AA seqDB search MTDATLTMYTTTWCGYCRTLKTQLRASGIAFTEIDVEQVPDAAEFVERVNGGNRTVPTVV YPDGTAATNPSLAEVKAALAN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgccacgctgaccatgtacaccacgacgtggtgcgggtactgccgcaccctc aagacgcagctcagggcgtcgggcatcgcgttcacggagatcgacgtcgagcaggtgccg gacgccgcggagttcgtggagcgcgtcaacggcggcaaccggaccgtgccgaccgtcgtc taccccgacgggaccgccgcgaccaacccgtcgttggccgaggtcaaggcggcgctggcg aactga

DBGET integrated database retrieval system