Xanthomonas citri pv. citri mf20: J172_00634 Help Entry J172_00634        CDS       T03781                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism xcf  Xanthomonas citri pv. citri mf20 Brite KEGG Orthology (KO) [BR:xcf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:xcf03000]     J172_00634    03036 Chromosome and associated proteins [BR:xcf03036]     J172_00634    03400 DNA repair and recombination proteins [BR:xcf03400]     J172_00634 Transcription factors [BR:xcf03000]  Prokaryotic type   Helix-turn-helix    Other families     J172_00634 Chromosome and associated proteins [BR:xcf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J172_00634 DNA repair and recombination proteins [BR:xcf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       J172_00634 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 Fis_N HTH_30 Phage_NinH HTH_29 BrkDBD Xre-like-HTH ZNHIT3_C HTH_28 HTH_23 HTH_17 Motif Other DBs NCBI-ProteinID:  AJZ07233 LinkDB All DBs Position complement(612949..613221) Genome browser AA seq 90 aa AA seqDB search MNAAPSRPDTSRGAPKSPLREHVAQSVRRYLRDLDGSDADDVYEIVLREMEIPLFVEVLN HCEGNQSRAAAMLGIHRATLRKKLKEYGLT NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaacgcagccccctctcgtcctgacaccagtcgtggcgccccgaagtcgcccctgcgc gaacacgtggcccagtccgttcgccgttatctgcgcgacctggacggcagcgacgcggac gacgtttacgaaatcgtgctgcgcgagatggagatcccgttgttcgtcgaagtgctcaac cactgcgaaggcaatcagagccgcgctgcggcgatgctgggcattcatcgggcaaccttg cgcaagaagcttaaagagtacgggctgacgtaa

DBGET integrated database retrieval system