KEGG   Xanthomonas citri pv. citri mf20: J172_01160
Entry
J172_01160        CDS       T03781                                 
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J172_01160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:xcf02022]
    J172_01160
Two-component system [BR:xcf02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   J172_01160
SSDB
Motif
Pfam: Trans_reg_C Response_reg
Other DBs
NCBI-ProteinID: AJZ07751
UniProt: A0A0U4YIF6
LinkDB
Position
complement(1203396..1204085)
AA seq 229 aa
MQKRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREAQTAIADRVPDLILLDWMLPGTS
GLDLARRWRKEQLTREIPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVM
RRTREDDEDGSVAVGKLRIDGAAHRVFAGDAPVPIGPTEYRLLHFFMTHPERVYTRTQLL
DHVWGGSVYVEERTIDVHIRRLRKTLEPFGLENMVQTVRGSGYRFSSAT
NT seq 690 nt   +upstreamnt  +downstreamnt
gtgcagaaacgcattctgatcgtcgatgacgaacccgcgatccgcgacatggtggcgttc
gcgctgcgcaaaggcgagttcgagcccatccatgccggcgatgcccgcgaggcgcaaacc
gccatcgccgaccgcgtgccggacctgatcctgctggactggatgttgccaggcaccagc
gggctggacctggcaaggcgctggcgcaaggagcagctgacccgcgagattccgatcatc
atgctcaccgcgcgcggcgaagaaaacgaccgcgtcggcggcctggaagccggcgtcgac
gattatgtggtcaagccgttctcggcgcgcgagctgctggcacgcatccgcgcggtgatg
cggcgcacccgcgaagacgacgaagacggtagcgtggcggtaggcaagctgcgcatcgac
ggcgccgcgcaccgggtgttcgctggcgatgcaccggtgccgatcggcccgaccgaatat
cggctgctgcactttttcatgacacaccccgagcgcgtgtatacgcgtacccagctactg
gaccatgtctggggcggcagcgtgtatgtggaagagcgcaccatcgacgtgcatatccgc
cgcctgcgcaagacgctggaaccgttcgggctggaaaacatggtgcagaccgtacgtggc
tccggctatcgtttttcttcggcgacctga

DBGET integrated database retrieval system