Xanthomonas citri pv. citri mf20: J172_01162 Help Entry J172_01162        CDS       T03781                                  Name (GenBank) Glutaredoxin, GrxC family   KO K03676   glutaredoxin 3 Organism xcf  Xanthomonas citri pv. citri mf20 Brite KEGG Orthology (KO) [BR:xcf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:xcf03110]     J172_01162 Chaperones and folding catalysts [BR:xcf03110]  Protein folding catalysts   Protein disulfide isomerase    J172_01162 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin DSBA Glrx-like Thioredoxin_2 GST_N_3 GST_N_2 SH3BGR Motif Other DBs NCBI-ProteinID:  AJZ07753 UniProt:  A0A0U5FBA8 LinkDB All DBs Position 1206064..1206372 Genome browser AA seq 102 aa AA seqDB search MSQDHTDQDAASGPQITLYSSAICPYCVAAKNFLKSKGKTWTEVRIDLDPAERDKMVALA KRTSVPQIFVGDVHVGGYDDMMAMHRAGKLEPLLAGSAGGQA NT seq 309 nt NT seq  +upstreamnt  +downstreamnt gtgagccaagaccataccgatcaggacgcggcctccggcccgcagatcaccctgtattcc tccgccatctgcccgtattgcgtggcggccaagaacttcctcaagagcaagggcaagacc tggaccgaggtgcggatcgacctggacccggccgagcgcgacaagatggtcgccctggcc aagcgcaccagcgtgccgcagatcttcgtcggcgacgtccatgtgggtggctacgacgac atgatggccatgcatcgtgccggcaagctcgagccgctgctggccggcagcgcgggcggc caggcatga

DBGET integrated database retrieval system