Xanthomonas citri pv. citri mf20: J172_01253 Help Entry J172_01253        CDS       T03781                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xcf  Xanthomonas citri pv. citri mf20 Pathway xcf01100   Metabolic pathways xcf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xcf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J172_01253    00074 Mycolic acid biosynthesis     J172_01253   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J172_01253 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AJZ07833 UniProt:  A0A0U5FAR7 LinkDB All DBs Position 1278349..1278588 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgatctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtgcagcaggcgatcgactacgtcaaggctcacgtcaagagctga

DBGET integrated database retrieval system