Xanthomonas citri pv. citri mf20: J172_03829 Help Entry J172_03829        CDS       T03781                                  Name (GenBank) ATP synthase, F0 subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism xcf  Xanthomonas citri pv. citri mf20 Pathway xcf00190   Oxidative phosphorylation xcf01100   Metabolic pathways Module xcf_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:xcf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     J172_03829  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:xcf00194]     J172_03829 Photosynthesis proteins [BR:xcf00194]  Photosystem and electron transport system   F-type ATPase [OT]    J172_03829 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF751 bPH_10 Motif Other DBs NCBI-ProteinID:  AJZ10365 UniProt:  A0A0U5FN07 LinkDB All DBs Position complement(4332887..4333189) Genome browser AA seq 100 aa AA seqDB search MYLAVLTNLAQVQSSTVLAVGIMIGLAALGAGLGLAIMAGKFLESAARQPELIPVLQVRM FITAGLIDAAFIISVAVGLLFAFANPLAQVFIERLSQAAG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtacctcgccgtcctgaccaacctcgctcaagtccagagctccaccgtcctcgccgtc ggcatcatgatcggcctggccgcgctgggtgccggcctcggtctggccatcatggctggc aagttcctggaatcggctgcgcgccagccggagctgatcccggtgctgcaggttcgtatg ttcatcaccgccggcctgatcgacgccgcgttcatcatcagcgtcgctgtcggcctgctg ttcgccttcgccaacccgctggcccaggtgttcatcgagcgtctgtcgcaggctgccggc tga

DBGET integrated database retrieval system