KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00293
Entry
XCAW_00293        CDS       T02519                                 
Symbol
ecnA
Name
(GenBank) entericidin A
  KO
K16347  entericidin A
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Brite
KEGG Orthology (KO) [BR:xci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xci02000]
    XCAW_00293 (ecnA)
Transporters [BR:xci02000]
 Other transporters
  Others
   XCAW_00293 (ecnA)
SSDB
Motif
Pfam: Entericidin
Other DBs
NCBI-ProteinID: AGI06118
LinkDB
Position
363909..364061
AA seq 50 aa
MKRLLTLMVLGLFSAGVMTGCNTVAGAGKDMQGAGNKVEKTAEKCSDGKC
NT seq 153 nt   +upstreamnt  +downstreamnt
atgaagcgactgctgacactgatggtgctgggcctgttttcggccggcgtgatgacgggc
tgcaacaccgtggccggcgccggcaaggacatgcagggtgcgggcaacaaggtcgagaaa
acggccgaaaaatgcagcgacggtaagtgctga

DBGET integrated database retrieval system