Xanthomonas citri subsp. citri Aw12879: XCAW_00663
Help
Entry
XCAW_00663 CDS
T02519
Symbol
accC
Name
(GenBank) Biotin carboxylase
KO
K01968
3-methylcrotonyl-CoA carboxylase alpha subunit [EC:
6.4.1.4
]
Organism
xci
Xanthomonas citri subsp. citri Aw12879
Pathway
xci00280
Valine, leucine and isoleucine degradation
xci01100
Metabolic pathways
Module
xci_M00036
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:
xci00001
]
09100 Metabolism
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
XCAW_00663 (accC)
Enzymes [BR:
xci01000
]
6. Ligases
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.4 methylcrotonoyl-CoA carboxylase
XCAW_00663 (accC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
BT_MCC_alpha
Biotin_lipoyl
ATP-grasp
Dala_Dala_lig_C
HlyD_3
Biotin_lipoyl_2
HlyD_D23
GARS_A
ATP-grasp_3
ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID:
AGI06482
LinkDB
All DBs
Position
complement(778655..780682)
Genome browser
AA seq
675 aa
AA seq
DB search
MTQRDPIAAATQAPFDKILIANRGEIACRVIATCRALGIATVAVYSDADRNARHVRMADE
AVHIGAAPAQQSYLRGEAILQAARATGAQAIHPGYGFLSENAAFAEACAHAGIVFIGPPA
AAIRAMGDKSAAKALMQRAGVPLTPGYHGDEQAPAFLRAQADAIGYPVLIKASAGGGGKG
MRRVDASAAFDDALASCQREAQSAFGNAHVLVEKYVQRPRHIEIQVFGDTHGEVVYLFER
DCSVQRRHQKVLEEAPAPGMSEARRAAMGRAAVDAAQAVGYVGAGTVEFIAGPDGDFYFM
EMNTRLQVEHPVTELITGTDLVEWQLRVAAGARLPRRQHELRIHGHALEARLYAEDAERG
FLPSTGTLRQLQMPAASAHVRVDAGVEQGDTISPYYDPMIAKLIVWDTDRPAALARMRAA
LAQFHAIGVTTNSAFLSRLIATDSFASANLDTALIEREHAVLFPEARSPDNAWWCLAAVL
IADALPAVAVDPADPHSPWQHTDGWRIGAHAAQRIVLEANGERRQLAVRPDADGWQVTNA
DQMHTLRYHRHETGLRVEMDGRQWRAQVLRDGATLTLIGARQRAVFRHHDALAEADQPTQ
EAGGLTAPMPGRIVSLPATVGQPVARGQALVVLEAMKMEHTLHAPSDGTVQAYLVAEGDL
VDDGAALVEFVSASA
NT seq
2028 nt
NT seq
+upstream
nt +downstream
nt
atgacccagcgcgaccctatcgccgcagcaacgcaagcgcccttcgacaagatcctgatc
gccaatcgcggcgagatcgcctgccgcgtcatcgccacctgccgcgccctgggcattgcg
acggtggcggtgtactcggatgcagaccgcaatgcacggcatgtgcgcatggcggacgag
gcagtgcatatcggcgccgcccccgcgcagcagagctatctgcgtggcgaagcgatcctg
caagcagcacgcgccaccggtgcgcaggcgatccatcccggttatggcttcctgtcggaa
aacgcggcatttgccgaggcctgcgcacatgctggcatcgtcttcatcggcccgccggca
gcggcgattcgcgcgatgggcgacaagagtgcggccaaggcactgatgcaacgggccggc
gtgccgctgacgccgggttaccacggtgacgaacaggcgccggcattcttgcgtgcgcaa
gccgatgcaatcggctatccggtgttgatcaaggccagtgctggcggtggcggcaagggc
atgcgccgtgtggatgccagcgcagcgttcgacgacgcgttggccagttgccagcgtgag
gcgcagtcggcattcggcaatgcgcacgtgctggtggaaaaatatgtccaacggccgcgg
cacatcgaaatccaggtgttcggcgatacgcatggcgaggtggtgtacctgttcgaacgc
gactgctcggtgcagcgccgccaccagaaggtgctggaagaagcgccggcgcccggcatg
agcgaggccaggcgcgccgcgatgggcagggcggcggtggatgcggcgcaggcggtgggc
tacgtgggtgccggtaccgtggaattcatcgccggcccggacggcgatttctatttcatg
gaaatgaacacccgtctgcaggtggagcacccggtgaccgaattgatcaccggcaccgat
ctggtcgagtggcaattgcgggttgccgcaggcgcgcgcttgccgcgcaggcagcacgag
ctgcgcatccacgggcatgcgctggaagcgcgcctgtacgccgaagatgccgagcgtggc
tttctaccctccaccggcacgctgcgtcagttgcagatgcctgctgccagtgcgcatgtg
cgtgtggatgcgggcgtagagcaaggcgacaccatcagcccttattacgacccgatgatc
gccaagctgatcgtctgggataccgatcgcccggccgcattggcacgcatgcgcgcggcg
ttggcgcaattccacgcgatcggtgtcaccaccaacagtgcatttctgtcgcgcctgatc
gcgaccgactcgttcgcgtcggcgaatctggacaccgcgttgatcgagcgcgaacacgcc
gtgctgttcccagaggcgcgcagccccgacaacgcctggtggtgcctggcagcggtgttg
attgccgatgcattgccggcagtggccgttgatccggccgatccgcattcgccgtggcag
cacacggacggttggcgcatcggtgcgcatgcagcgcagcgcatcgtcctggaagcgaac
ggcgagcgccgccaactcgctgtgcgcccggatgccgatggctggcaagtcaccaacgca
gaccagatgcataccttgcgctaccaccggcacgagacgggcttgcgtgtggagatggat
ggccggcaatggcgtgcacaggtgttgcgcgacggcgccacgctgaccctgatcggggcc
aggcaacgggccgtcttccgtcaccacgatgcactggcagaagccgaccagcctacccag
gaggccggcggactgaccgcaccgatgcccgggcgcatcgtgtccctgcccgcaacagtg
ggccagccggtcgcccgtgggcaggcactggtggtgctggaagcgatgaaaatggagcac
accctgcacgcgcccagcgatggcaccgtgcaggcgtacctggtggctgagggcgatctg
gtggatgacggtgcggcgctggtggaatttgtgtccgcgtctgcgtag
DBGET
integrated database retrieval system