Xanthomonas citri subsp. citri Aw12879: XCAW_00807 Help Entry XCAW_00807        CDS       T02519                                  Symbol hrpE Name (GenBank) HrpE protein   KO K18375   type III secretion hrp pilus HrpE Organism xci  Xanthomonas citri subsp. citri Aw12879 Module xci_M00660   Xanthomonas spp. pathogenicity signature, T3SS and effectors Brite KEGG Orthology (KO) [BR:xci00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xci02044]     XCAW_00807 (hrpE) Secretion system [BR:xci02044]  Type III secretion system   Type III secretion related proteins    XCAW_00807 (hrpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AGI06624 LinkDB All DBs Position complement(933195..933476) Genome browser AA seq 93 aa AA seqDB search MELLPQISSIKSRFDQGTDAYTGGVSGGISGEAALTGANGQMSSLISDMTASDEAQKSMN NKITQLKNDLDFNVALNKFIGKAGDNAKQLVGQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaattattaccgcaaatcagttcaatcaaatcgcgttttgaccagggcacggacgcc tacaccgggggtgtgtccggtggaatctctggtgaggctgcactcacgggcgcgaacggg cagatgagttcgttgatcagtgacatgaccgcctcggacgaggcccagaagtccatgaac aacaagatcacgcagcttaaaaatgatctggacttcaacgtggcgctgaacaagttcatc ggcaaggccggcgacaacgccaagcagctcgttggccagtaa

DBGET integrated database retrieval system