Xanthomonas citri subsp. citri Aw12879: XCAW_00811 Help Entry XCAW_00811        CDS       T02519                                  Symbol hrcS Name (GenBank) HrcS protein   KO K03227   type III secretion protein S Organism xci  Xanthomonas citri subsp. citri Aw12879 Pathway xci03070   Bacterial secretion system Module xci_M00660   Xanthomonas spp. pathogenicity signature, T3SS and effectors Brite KEGG Orthology (KO) [BR:xci00001]  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     XCAW_00811 (hrcS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xci02044]     XCAW_00811 (hrcS) Secretion system [BR:xci02044]  Type III secretion system   Type III secretion core apparatus    XCAW_00811 (hrcS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_export_3 CDP-OH_P_tran_2 PhaG_MnhG_YufB DUF1002 DUF6611 Motif Other DBs NCBI-ProteinID:  AGI06628 LinkDB All DBs Position complement(935554..935814) Genome browser AA seq 86 aa AA seqDB search MDHDDLVRFTSEALLLCLKVSLPVVGVAALAGLLIAFIQAVMSLQDASISFALKLVVVVA AIAVTAPWGASAIMQFGQALMQAAFP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggaccacgacgatctagtgcgatttacctccgaagcgttgctgctctgcctcaaggtc tccttgccggtggtcggtgtcgctgcgctggccgggctgttgatcgccttcatccaggcg gtgatgtcgctgcaggacgcatcgatttcgttcgcgctcaagctggtggtggtggtggcc gccattgcggtgacggcgccgtggggcgcgtcggcgatcatgcagttcggccaggcattg atgcaggcggcgttcccatga

DBGET integrated database retrieval system