Xanthomonas citri subsp. citri Aw12879: XCAW_01838 Help Entry XCAW_01838        CDS       T02519                                  Name (GenBank) Hypothetical Protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism xci  Xanthomonas citri subsp. citri Aw12879 Pathway xci02020   Two-component system xci02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:xci00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     XCAW_01838  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     XCAW_01838  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:xci02035]     XCAW_01838 Bacterial motility proteins [BR:xci02035]  Flagellar system   Flagellar assembly proteins    Others     XCAW_01838 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM YdgH_BhsA-like HTH_Cmi2_C DUF3073 Motif Other DBs NCBI-ProteinID:  AGI07629 LinkDB All DBs Position complement(2047512..2047823) Genome browser AA seq 103 aa AA seqDB search MTQKIEGNLPTAATLRTTATSSKIASAGEDRASPVAATPPTDSVKLTGEATNLQNLQREL SQSSAIDTGRVQAVKDALQNGSYSINPDAIASRMMDLNQQLAG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgacccagaaaatcgaaggcaatctaccgaccgctgccacccttcgcaccacggccacc agcagcaagatcgcttcggccggcgaagatcgcgcgtccccggttgccgcaaccccgccg accgacagcgtcaagttgaccggcgaagccaccaacctgcagaacctgcagcgcgagctt tcgcagtcctcggcgatcgacaccggtcgcgtccaggcggtgaaggatgcattgcagaac ggcagctattccatcaacccggacgccatcgccagccgcatgatggatctgaatcagcaa ctggcgggttga

DBGET integrated database retrieval system