Xanthomonas citri subsp. citri Aw12879: XCAW_02003 Help Entry XCAW_02003        CDS       T02519                                  Name (GenBank) Hypothetical Protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism xci  Xanthomonas citri subsp. citri Aw12879 Pathway xci00190   Oxidative phosphorylation xci01100   Metabolic pathways xci02020   Two-component system Module xci_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:xci00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     XCAW_02003  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     XCAW_02003 Enzymes [BR:xci01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      XCAW_02003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB MFS_1 Motif Other DBs NCBI-ProteinID:  AGI07794 LinkDB All DBs Position 2213820..2213930 Genome browser AA seq 36 aa AA seqDB search MWYFAWILGTGLAALAAVLNGMWFEAREPERGEPSQ NT seq 111 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggatactcggcaccggcctggcggcattggccgcggtgctcaac ggcatgtggttcgaagcacgcgagcccgagcgtggcgaaccgtctcagtaa

DBGET integrated database retrieval system