Xanthomonas citri subsp. citri UI6: J158_02501 Help Entry J158_02501        CDS       T03894                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism xcj  Xanthomonas citri subsp. citri UI6 Pathway xcj00190   Oxidative phosphorylation xcj01100   Metabolic pathways xcj02020   Two-component system Module xcj_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:xcj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     J158_02501  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     J158_02501 Enzymes [BR:xcj01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      J158_02501 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB MFS_1 Motif Other DBs NCBI-ProteinID:  AJY86883 LinkDB All DBs Position 2722662..2722772 Genome browser AA seq 36 aa AA seqDB search MWYFAWILGTGLAALAAVLNGMWFEAREPERGEPSQ NT seq 111 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggatactcggcaccggcctggcggcattggccgcggtgctcaac ggcatgtggttcgaagcacgcgagcccgagcgtggcgaaccgtctcagtaa

DBGET integrated database retrieval system