Xanthomonas citri subsp. citri UI6: J158_04233 Help Entry J158_04233        CDS       T03894                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism xcj  Xanthomonas citri subsp. citri UI6 Pathway xcj01100   Metabolic pathways xcj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xcj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J158_04233    00074 Mycolic acid biosynthesis     J158_04233   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J158_04233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJY88588 LinkDB All DBs Position complement(4751954..4752223) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVQANKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctggtcgaaagtctgaac ctggaagacgtccagcccgccgacatcgatccggaggcgccgttgttcaataccgggctg gggctggactcgatcgacgcactggaactggcgctggcgatcagcaagcgctacggcttc cagttgcgctcggacaacgacgaaaaccgtcgcatcttcgcgtcgctgcgcgcactgtcg gcgcatgtccaagccaacaagaccgtctga

DBGET integrated database retrieval system