Candidatus Xianfuyuplasma coldseepsis: G4Z02_03915 Help Entry G4Z02_03915       CDS       T08386                                  Name (GenBank) chorismate mutase   KO K04516   chorismate mutase [EC:5.4.99.5] Organism xcl  Candidatus Xianfuyuplasma coldseepsis Pathway xcl00400   Phenylalanine, tyrosine and tryptophan biosynthesis xcl01100   Metabolic pathways xcl01110   Biosynthesis of secondary metabolites xcl01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:xcl00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     G4Z02_03915 Enzymes [BR:xcl01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      G4Z02_03915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 TSC22 Motif Other DBs NCBI-ProteinID:  QMS84934 UniProt:  A0A7L7KSL3 LinkDB All DBs Position 834492..834740 Genome browser AA seq 82 aa AA seqDB search MDRLKALRSEIDDLDQSIMELLEKRMDIAIEIGNYKQLKNITVFDSSREQSILEKASTFS HSPQISNIYKAIMKESKSLQRK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggatcggttaaaggccttacgtagcgagattgatgatctagatcaatccattatggaa ttgttagaaaaacgaatggacatagccattgaaattggtaactataaacaattaaaaaat attacagttttcgattcaagtagagaacaatcaatattagaaaaagcgtccacatttagc cattctccacaaatatcaaacatctataaagcaattatgaaggagagtaaatccctacaa aggaagtag

DBGET integrated database retrieval system