Xanthomonas citri pv. citri MN12: J164_00639 Help Entry J164_00639        CDS       T03735                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism xcm  Xanthomonas citri pv. citri MN12 Brite KEGG Orthology (KO) [BR:xcm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:xcm03000]     J164_00639    03036 Chromosome and associated proteins [BR:xcm03036]     J164_00639    03400 DNA repair and recombination proteins [BR:xcm03400]     J164_00639 Transcription factors [BR:xcm03000]  Prokaryotic type   Helix-turn-helix    Other families     J164_00639 Chromosome and associated proteins [BR:xcm03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J164_00639 DNA repair and recombination proteins [BR:xcm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       J164_00639 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 Fis_N HTH_30 Phage_NinH HTH_29 BrkDBD Xre-like-HTH ZNHIT3_C HTH_28 HTH_23 HTH_17 Motif Other DBs NCBI-ProteinID:  AJY93962 LinkDB All DBs Position complement(612957..613229) Genome browser AA seq 90 aa AA seqDB search MNAAPSRPDTSRGAPKSPLREHVAQSVRRYLRDLDGSDADDVYEIVLREMEIPLFVEVLN HCEGNQSRAAAMLGIHRATLRKKLKEYGLT NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaacgcagccccctctcgtcctgacaccagtcgtggcgccccgaagtcgcccctgcgc gaacacgtggcccagtccgttcgccgttatctgcgcgacctggacggcagcgacgcggac gacgtttacgaaatcgtgctgcgcgagatggagatcccgttgttcgtcgaagtgctcaac cactgcgaaggcaatcagagccgcgctgcggcgatgctgggcattcatcgggcaaccttg cgcaagaagcttaaagagtacgggctgacgtaa

DBGET integrated database retrieval system