Xanthomonas citri pv. citri MN12: J164_00894 Help Entry J164_00894        CDS       T03735                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xcm  Xanthomonas citri pv. citri MN12 Brite KEGG Orthology (KO) [BR:xcm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xcm03036]     J164_00894 Chromosome and associated proteins [BR:xcm03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     J164_00894 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC DUF7342 Motif Other DBs NCBI-ProteinID:  AJY94215 UniProt:  A0A0U5FC94 LinkDB All DBs Position 916247..916510 Genome browser AA seq 87 aa AA seqDB search MSRLLLVVLLACSIASAIGVVYMRHMHRKLFVQLSKLEHTRDELNIEFGRLQLEQATWAE SNRVDQVARARIGMKFPETNDIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgcttgctgctcgtcgtgctgcttgcctgcagcatcgcctcggcgatcggtgtg gtgtatatgcgccatatgcatcgcaagctgttcgtgcagttgtccaagctcgaacacaca cgcgacgaattgaatatcgaattcggccggctgcagctggagcaggccacgtgggcggaa agcaaccgggtcgaccaggtcgcgcgtgcgcgcatcgggatgaagttcccggagaccaac gacatcgtggtggtgcgcccatga

DBGET integrated database retrieval system