Xanthomonas citri pv. citri NT17: J169_00894 Help Entry J169_00894        CDS       T03734                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xcn  Xanthomonas citri pv. citri NT17 Brite KEGG Orthology (KO) [BR:xcn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xcn03036]     J169_00894 Chromosome and associated proteins [BR:xcn03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     J169_00894 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC DUF7342 Motif Other DBs NCBI-ProteinID:  AJY89744 UniProt:  A0A0U5FC94 LinkDB All DBs Position 916245..916508 Genome browser AA seq 87 aa AA seqDB search MSRLLLVVLLACSIASAIGVVYMRHMHRKLFVQLSKLEHTRDELNIEFGRLQLEQATWAE SNRVDQVARARIGMKFPETNDIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgcttgctgctcgtcgtgctgcttgcctgcagcatcgcctcggcgatcggtgtg gtgtatatgcgccatatgcatcgcaagctgttcgtgcagttgtccaagctcgaacacaca cgcgacgaattgaatatcgaattcggccggctgcagctggagcaggccacgtgggcggaa agcaaccgggtcgaccaggtcgcgcgtgcgcgcatcgggatgaagttcccggagaccaac gacatcgtggtggtgcgcccatga

DBGET integrated database retrieval system