Xanthomonas campestris pv. raphani: XCR_0885 Help Entry XCR_0885          CDS       T01872                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xcp  Xanthomonas campestris pv. raphani Brite KEGG Orthology (KO) [BR:xcp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xcp03036]     XCR_0885 (ftsL) Chromosome and associated proteins [BR:xcp03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     XCR_0885 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC Motif Other DBs NCBI-ProteinID:  AEL05802 LinkDB All DBs Position 923874..924137 Genome browser AA seq 87 aa AA seqDB search MSRLLLIVLLACSIASAIGVVYMRHMHRKLFVQLSKLEHSRDELNIEFGRLQLEQATWAE SNRVDQVSRERIGMKFPETSDIVVIRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgcctgctgctcatcgtgctgctcgcctgcagcatcgcctcggcgatcggtgtg gtgtacatgcgccacatgcatcgcaagttgttcgtgcagttgtccaagctcgaacacagt cgcgatgaattgaatatcgaattcggccggctgcagctggagcaggccacgtgggcggaa agcaaccgcgtggatcaggtctcgcgtgagcgcatcgggatgaagttcccggagaccagc gacatcgtggtgatccgcccatga

DBGET integrated database retrieval system