Xanthomonas campestris pv. raphani: XCR_1473 Help Entry XCR_1473          CDS       T01872                                  Symbol hrpE Name (GenBank) type III secretion pilin HrpE   KO K18375   type III secretion hrp pilus HrpE Organism xcp  Xanthomonas campestris pv. raphani Module xcp_M00660   Xanthomonas spp. pathogenicity signature, T3SS and effectors Brite KEGG Orthology (KO) [BR:xcp00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xcp02044]     XCR_1473 (hrpE) Secretion system [BR:xcp02044]  Type III secretion system   Type III secretion related proteins    XCR_1473 (hrpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AEL06372 LinkDB All DBs Position complement(1505350..1505496) Genome browser AA seq 48 aa AA seqDB search MGGIGKSAAAQERMNNYLTAKKNELDFNVALNKFIGKAGDNAKQLVGQ NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgggtggcattggtaaatcagccgcagcacaggagcgcatgaacaactacctgaccgcg aagaagaacgaacttgacttcaacgtggcgctcaacaaattcatcggcaaggcaggcgac aacgctaagcagctggttggccagtaa

DBGET integrated database retrieval system