KEGG   Xanthomonas campestris pv. raphani: XCR_3567
Entry
XCR_3567          CDS       T01872                                 
Name
(GenBank) methanol dehydrogenase regulatory protein
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
xcp  Xanthomonas campestris pv. raphani
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XCR_3567
SSDB
Motif
Pfam: AAA_3 AAA_lid_2 bpMoxR AAA_5 AAA Mg_chelatase RuvB_N Sigma54_activat MCM AAA_16 AAA_22
Other DBs
NCBI-ProteinID: AEL08428
LinkDB
Position
complement(3799470..3800489)
AA seq 339 aa
MNAPPLLPPEAAAAPAEDRLHGQFTALRESLAQRIVGQSALVERLLIALLADGHLLVEGA
PGLAKTTAIRALASRLETDFARVQFTPDLLPADLTGTEIWRPQEGRFEFMPGPIFHPILL
ADEINRAPAKVQSALLEAMGERQVTVGRHTYALPQLFLVMATQNPIEQEGTFPLPEAQLD
RFLMHVRIGYPQADAEAEILRLARETARDTLEKHATVPDKIPLEDVFAARRVVLDVHLAP
QLERYLIEIVLASRDAQRYDPALARRIAWGASPRGSIALERCARARAWLAGRDYVTPDDI
RAIAPDVLRHRVLPSYEATAEGWDGERLVAALLEKIPLP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaacgcaccgccgctccttccgccagaagccgccgccgcgcccgccgaggaccggctg
catggtcaattcaccgcgctgcgcgagtcgctggcgcaacgcatcgtggggcagtccgcg
ttggtcgagcggctgctgatcgccttgctggccgacggccacctgttggtggagggcgcg
cccggcctggccaagaccaccgcgatccgcgcactggcctcacggctggaaaccgatttt
gcgcgcgtccagttcacgccggacctgctgccggccgatctgaccggcaccgagatctgg
cggccgcaggaagggcgcttcgagttcatgcccgggccgatcttccatccgattttgctc
gccgatgaaatcaaccgtgcgccggccaaggtgcagtcggcgctgctggaagcgatgggc
gagcggcaggtcacggtgggccggcatacctatgccttgccgcaactgttcctggtgatg
gccacgcagaatccgatcgagcaggagggtacgttcccgctgcccgaggcgcagttggac
cgctttctgatgcatgtgcggatcgggtatccgcaggccgatgcggaggccgagatcctg
cggctggcgcgtgaaaccgcacgcgacaccctggaaaagcatgcgacggtgccggacaag
attccgctggaagatgtgttcgccgcacgccgcgtggtgctggatgtgcatcttgcgccg
cagctcgagcgctacctgatcgagatcgtgctggcgtcgcgcgatgcgcagcgttacgac
cctgcgctggcgcggcgtatcgcctggggcgcaagcccgcgtggctcaatcgcgctggaa
cgctgcgcgcgcgcacgtgcgtggttggccggccgcgattacgtgaccccggacgatatc
cgcgccatcgcgccggacgtgctgcgccatcgcgtgctgcccagctacgaagccaccgcc
gaaggctgggatggcgaacgtctggtcgccgcgctgttggaaaagattccgctgccctga

DBGET integrated database retrieval system