Xanthomonas citri pv. citri MN11: J163_02688
Help
Entry
J163_02688 CDS
T03780
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
xcr
Xanthomonas citri pv. citri MN11
Pathway
xcr00770
Pantothenate and CoA biosynthesis
xcr01100
Metabolic pathways
xcr01240
Biosynthesis of cofactors
Module
xcr_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
xcr00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
J163_02688
Enzymes [BR:
xcr01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
J163_02688
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AJZ00386
UniProt:
A0A0U5FEV0
LinkDB
All DBs
Position
complement(2946760..2947266)
Genome browser
AA seq
168 aa
AA seq
DB search
MSVANSRTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPALSLERRVALAQ
EALAAHANVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL
FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQVRQSRAQA
NT seq
507 nt
NT seq
+upstream
nt +downstream
nt
atgagcgttgccaatagccgcaccgccgtctatcccggtaccttcgacccgatcaccaat
gggcatatcgacctggtgaatcgcgccgcgccgttgttcgagcgggtggtggtgggcgtg
gcgtacagcccctccaagggcccggcgttgtcgctggagcgccgcgtggcgctggcccag
gaagcgctggcggcgcatgccaatgtggaagtgcgcggcttcgataccttgctggcgcat
ttcgtgcgcgagatgggcgccggcgtgctgctgcgcggcctgcgcgcagtgtccgacttc
gaatacgaattccagatggccagcatgaaccgccatctgatcccggaggtggaaacgctg
tttctcaccccggccgagcaatacagcttcatctcgtcctcgctggtgcgcgaaatcgcg
cggctgggcggggatgtgtccggcttcgtgccggcatcggttgtcgaggccttgcggcag
gtgcggcagtcccgcgcgcaggcctga
DBGET
integrated database retrieval system