KEGG   Xanthomonas cerealis: KHA79_01205
Entry
KHA79_01205       CDS       T10673                                 
Name
(GenBank) entericidin A/B family lipoprotein
  KO
K16347  entericidin A
Organism
xcs  Xanthomonas cerealis
Brite
KEGG Orthology (KO) [BR:xcs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcs02000]
    KHA79_01205
Transporters [BR:xcs02000]
 Other transporters
  Others
   KHA79_01205
SSDB
Motif
Pfam: Entericidin
Other DBs
NCBI-ProteinID: UKE47388
LinkDB
Position
278529..278663
AA seq 44 aa
MKRTFAWMLLAMFSVGLLSGCNTVAGAGKDVKSAGEKVEDAAKN
NT seq 135 nt   +upstreamnt  +downstreamnt
atgaagcgtacttttgcgtggatgctgctggcgatgttttcggtgggcctgctgtcgggc
tgcaacacggttgccggtgccggcaaggacgtgaagagcgccggcgagaaggtcgaagac
gccgccaagaactga

DBGET integrated database retrieval system