Xanthomonas citri subsp. citri A306: J151_00898 Help Entry J151_00898        CDS       T03584                                  Name (GenBank) cell division protein   KO K03586   cell division protein FtsL Organism xct  Xanthomonas citri subsp. citri A306 Brite KEGG Orthology (KO) [BR:xct00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xct03036]     J151_00898 Chromosome and associated proteins [BR:xct03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     J151_00898 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC DUF7342 Motif Other DBs NCBI-ProteinID:  AJD67365 LinkDB All DBs Position 916240..916503 Genome browser AA seq 87 aa AA seqDB search MSRLLLVVLLACSIASAIGVVYMRHMHRKLFVQLSKLEHTRDELNIEFGRLQLEQATWAE SNRVDQVARARIGMKFPETNDIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgcttgctgctcgtcgtgctgcttgcctgcagcatcgcctcggcgatcggtgtg gtgtatatgcgccatatgcatcgcaagctgttcgtgcagttgtccaagctcgaacacaca cgcgacgaattgaatatcgaattcggccggctgcagctggagcaggccacgtgggcggaa agcaaccgggtcgaccaggtcgcgcgtgcgcgcatcgggatgaagttcccggagaccaac gacatcgtggtggtgcgcccatga

DBGET integrated database retrieval system