Xanthomonas citri subsp. citri A306: J151_04280 Help Entry J151_04280        CDS       T03584                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xct  Xanthomonas citri subsp. citri A306 Pathway xct01100   Metabolic pathways xct01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xct00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J151_04280    00074 Mycolic acid biosynthesis     J151_04280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J151_04280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJD70676 LinkDB All DBs Position complement(4803595..4803864) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVQANKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctggtcgaaagtctgaac ctggaagacgtccagcccgccgacatcgatccggaggcgccgttgttcaataccgggctg gggctggactcgatcgacgcactggaactggcgctggcgatcagcaagcgctacggcttc cagttgcgctcggacaacgacgaaaaccgtcgcatcttcgcgtcgctgcgcgcactgtcg gcgcatgtccaagccaacaagaccgtctga

DBGET integrated database retrieval system