Xanthomonas citri pv. citri UI7: J159_01259 Help Entry J159_01259        CDS       T03733                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xcu  Xanthomonas citri pv. citri UI7 Pathway xcu01100   Metabolic pathways xcu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xcu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J159_01259    00074 Mycolic acid biosynthesis     J159_01259   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J159_01259 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AJY81246 UniProt:  A0A0U5FAR7 LinkDB All DBs Position 1278356..1278595 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgatctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtgcagcaggcgatcgactacgtcaaggctcacgtcaagagctga

DBGET integrated database retrieval system