Xanthomonas citri pv. citri UI7: J159_03811 Help Entry J159_03811        CDS       T03733                                  Name (GenBank) ATP synthase, F0 subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism xcu  Xanthomonas citri pv. citri UI7 Pathway xcu00190   Oxidative phosphorylation xcu01100   Metabolic pathways Module xcu_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:xcu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     J159_03811  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:xcu00194]     J159_03811 Photosynthesis proteins [BR:xcu00194]  Photosystem and electron transport system   F-type ATPase [OT]    J159_03811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF751 bPH_10 Motif Other DBs NCBI-ProteinID:  AJY83754 UniProt:  A0A0U5FN07 LinkDB All DBs Position complement(4308565..4308867) Genome browser AA seq 100 aa AA seqDB search MYLAVLTNLAQVQSSTVLAVGIMIGLAALGAGLGLAIMAGKFLESAARQPELIPVLQVRM FITAGLIDAAFIISVAVGLLFAFANPLAQVFIERLSQAAG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtacctcgccgtcctgaccaacctcgctcaagtccagagctccaccgtcctcgccgtc ggcatcatgatcggcctggccgcgctgggtgccggcctcggtctggccatcatggctggc aagttcctggaatcggctgcgcgccagccggagctgatcccggtgctgcaggttcgtatg ttcatcaccgccggcctgatcgacgccgcgttcatcatcagcgtcgctgtcggcctgctg ttcgccttcgccaacccgctggcccaggtgttcatcgagcgtctgtcgcaggctgccggc tga

DBGET integrated database retrieval system