Xanthomonas citri pv. citri UI7: J159_04229 Help Entry J159_04229        CDS       T03733                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism xcu  Xanthomonas citri pv. citri UI7 Pathway xcu01100   Metabolic pathways xcu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xcu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J159_04229    00074 Mycolic acid biosynthesis     J159_04229   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J159_04229 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJY84162 UniProt:  A0A0U5GG60 LinkDB All DBs Position complement(4751811..4752080) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVQANKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctggtcgaaagtctgaac ctggaagacgtccagcccgccgacatcgatccggaggcgccgttgttcaataccgggctg gggctggactcgatcgacgcactggaactggcgctggcgatcagcaagcgctacggcttc cagttgcgctcggacaacgacgaaaaccgtcgcatcttcgcgtcgctgcgcgcactgtcg gcgcatgtccaagccaacaagaccgtctga

DBGET integrated database retrieval system