KEGG   Xanthomonas euvesicatoria pv. vesicatoria: XCV2835
Entry
XCV2835           CDS       T00288                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
xcv  Xanthomonas euvesicatoria pv. vesicatoria
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcv03016]
    XCV2835 (truB)
Enzymes [BR:xcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     XCV2835 (truB)
Transfer RNA biogenesis [BR:xcv03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    XCV2835 (truB)
 Prokaryotic type
    XCV2835 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 TruB_C
Other DBs
NCBI-ProteinID: CAJ24514
UniProt: Q3BRP7
LinkDB
Position
complement(3224909..3225835)
AA seq 308 aa
MKPRIVYRPLHGILLLDKPAGLSSNNALQAARRLLRAEKGGHTGSLDPLATGLLPLCFGE
ATKIAGLLLGSAKAYDAEIVLGVTTDTDDADGQPLRERAVPDLSEADLQAALAPFIGRIQ
QQAPIYSALKQGGEPLYAKARRGERIEAPVREVDVQAIDVLGYSAPGLRLRVTCGSGTYI
RSLARDLGEVLGCGAHIASLRRLWVEPFRAPQMITLEALSAALEAGTEARTLLLPIEAGL
AGFARIVLDQTHAARFRMGQRLRDAAFPPGQVAVFGPDGTPSGLGLVDADGRLSPQRLFN
GLNEIPAC
NT seq 927 nt   +upstreamnt  +downstreamnt
ttgaaaccccgcatcgtctatcgcccgttgcacggcatcctgctgctggacaagccggcc
gggctgagctccaacaatgcactgcaggccgcacgccggttattgcgtgcagagaagggc
ggccataccggcagcctggatccgctggctaccggcctgttgccgctctgctttggcgaa
gccaccaagatcgccggactgctgcttggttcagccaaggcatacgacgccgagatcgtg
ttgggcgtcaccaccgacaccgacgatgccgacggccagccgctgcgcgagcgtgcggtg
ccggatctgagcgaggccgatctacaggcggcgctggcgcctttcatcggccgtatccag
caacaagcgcccatttattccgcgctcaagcagggcggcgagccgctgtacgccaaggcg
cgacgcggcgaacgtatcgaagcgccggtgcgcgaggtggatgtgcaggcgatcgatgtg
ctgggctacagcgccccaggtctgcggctgcgcgtgacctgcggctcgggcacgtatatc
cgcagcctggcacgtgacctgggcgaggtgctgggatgtggagcgcacatcgcctcgttg
cgtcggctgtgggtggagccgtttcgcgctccacagatgatcacgctcgaggcattgtcg
gcggcgctggaggcgggcaccgaagcacggacgctattgctgccgatcgaggccggcctg
gccggttttgcgcgaatcgtgctcgatcagacccatgcggcgcgttttcgcatgggccag
cgcctgcgtgatgccgcatttccgccggggcaagtcgctgtattcggacctgacggaacc
ccctcggggctaggcctggtcgacgccgacgggcgcttgtcgccgcagcgattgttcaat
ggactgaacgaaattccggcctgttaa

DBGET integrated database retrieval system