Xanthomonas citri pv. citri MN10: J162_01819 Help Entry J162_01819        CDS       T03779                                  Name (GenBank) heme exporter protein CcmD   KO K02196   heme exporter protein D Organism xcw  Xanthomonas citri pv. citri MN10 Pathway xcw02010   ABC transporters Brite KEGG Orthology (KO) [BR:xcw00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     J162_01819  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:xcw02000]     J162_01819 Transporters [BR:xcw02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     J162_01819 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD CopD Motif Other DBs NCBI-ProteinID:  AJZ03963 UniProt:  A0A0U5BS84 LinkDB All DBs Position complement(1926046..1926252) Genome browser AA seq 68 aa AA seqDB search MSTFLAMGGYGQYVWTAYALFVLALLADLAAPWLRRRRLPRELRGQLQRQAPWRVRDQPA PALDREAP NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcacctttctggcgatgggcggctacggccagtacgtgtggaccgcctacgcattg ttcgtgctggcgctgctggccgatcttgcagcgccctggctgcgccgccgccggctgccg cgcgaactgcgcggccagttgcagcggcaggcaccgtggcgtgtacgcgatcaaccggca ccggcactggaccgcgaagcgccatga

DBGET integrated database retrieval system